Lineage for d2vy4a1 (2vy4 A:53-87)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035157Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
    simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC
  4. 3035158Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) (S)
  5. 3035521Family g.37.1.7: CHHC finger [161158] (1 protein)
  6. 3035522Protein U11/U12 small nuclear ribonucleoprotein 48 kDa protein, U11-48K [161159] (1 species)
  7. 3035523Species Human (Homo sapiens) [TaxId:9606] [161160] (2 PDB entries)
    Uniprot Q6IEG0 53-87
  8. 3035524Domain d2vy4a1: 2vy4 A:53-87 [153704]
    complexed with zn

Details for d2vy4a1

PDB Entry: 2vy4 (more details)

PDB Description: u11-48k chhc zn-finger domain
PDB Compounds: (A:) u11/u12 small nuclear ribonucleoprotein 48 kda protein

SCOPe Domain Sequences for d2vy4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vy4a1 g.37.1.7 (A:53-87) U11/U12 small nuclear ribonucleoprotein 48 kDa protein, U11-48K {Human (Homo sapiens) [TaxId: 9606]}
devvicpydsnhhmpksslakhmascrlrkmgytk

SCOPe Domain Coordinates for d2vy4a1:

Click to download the PDB-style file with coordinates for d2vy4a1.
(The format of our PDB-style files is described here.)

Timeline for d2vy4a1: