Lineage for d2vxjo_ (2vxj O:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1776981Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 1776982Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 1777493Family b.18.1.16: PA-IL, galactose-binding lectin 1 [82022] (1 protein)
    a truncated form of this fold lacking one of the N-terminal strands
    automatically mapped to Pfam PF07828
  6. 1777494Protein PA-IL, galactose-binding lectin 1 [82023] (1 species)
  7. 1777495Species Pseudomonas aeruginosa [TaxId:287] [82024] (18 PDB entries)
  8. 1777537Domain d2vxjo_: 2vxj O: [153694]
    automated match to d1l7la_
    complexed with bgc, ca, edo

Details for d2vxjo_

PDB Entry: 2vxj (more details), 1.9 Å

PDB Description: crystal structure of pa-il lectin complexed with agal13bgal14glc at 1.9 a resolution
PDB Compounds: (O:) PA-I galactophilic lectin

SCOPe Domain Sequences for d2vxjo_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vxjo_ b.18.1.16 (O:) PA-IL, galactose-binding lectin 1 {Pseudomonas aeruginosa [TaxId: 287]}
awkgevlanneagqvtsiiynpgdvitivaagwasygptqkwgpqgdrehpdqglichda
fcgalvmkignsgtipvntglfrwvapnnvqgaitliyndvpgtygnnsgsfsvnigkdq
s

SCOPe Domain Coordinates for d2vxjo_:

Click to download the PDB-style file with coordinates for d2vxjo_.
(The format of our PDB-style files is described here.)

Timeline for d2vxjo_: