Lineage for d2vxjf1 (2vxj F:1-121)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 792799Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 792800Superfamily b.18.1: Galactose-binding domain-like [49785] (32 families) (S)
  5. 793181Family b.18.1.16: PA-IL, galactose-binding lectin 1 [82022] (1 protein)
    a truncated form of this fold lacking one of the N-terminal strands
  6. 793182Protein PA-IL, galactose-binding lectin 1 [82023] (1 species)
  7. 793183Species Pseudomonas aeruginosa [TaxId:287] [82024] (4 PDB entries)
  8. 793194Domain d2vxjf1: 2vxj F:1-121 [153685]
    automatically matched to d1l7la_
    complexed with bgc, ca, edo, gal, gla, glc

Details for d2vxjf1

PDB Entry: 2vxj (more details), 1.9 Å

PDB Description: crystal structure of pa-il lectin complexed with agal13bgal14glc at 1.9 a resolution
PDB Compounds: (F:) PA-I galactophilic lectin

SCOP Domain Sequences for d2vxjf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vxjf1 b.18.1.16 (F:1-121) PA-IL, galactose-binding lectin 1 {Pseudomonas aeruginosa [TaxId: 287]}
awkgevlanneagqvtsiiynpgdvitivaagwasygptqkwgpqgdrehpdqglichda
fcgalvmkignsgtipvntglfrwvapnnvqgaitliyndvpgtygnnsgsfsvnigkdq
s

SCOP Domain Coordinates for d2vxjf1:

Click to download the PDB-style file with coordinates for d2vxjf1.
(The format of our PDB-style files is described here.)

Timeline for d2vxjf1: