Lineage for d2vxjb_ (2vxj B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2046279Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2046280Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2046806Family b.18.1.16: PA-IL, galactose-binding lectin 1 [82022] (1 protein)
    a truncated form of this fold lacking one of the N-terminal strands
    automatically mapped to Pfam PF07828
  6. 2046807Protein PA-IL, galactose-binding lectin 1 [82023] (1 species)
  7. 2046808Species Pseudomonas aeruginosa [TaxId:287] [82024] (19 PDB entries)
  8. 2046829Domain d2vxjb_: 2vxj B: [153681]
    automated match to d1l7la_
    complexed with bgc, ca, edo

Details for d2vxjb_

PDB Entry: 2vxj (more details), 1.9 Å

PDB Description: crystal structure of pa-il lectin complexed with agal13bgal14glc at 1.9 a resolution
PDB Compounds: (B:) PA-I galactophilic lectin

SCOPe Domain Sequences for d2vxjb_:

Sequence, based on SEQRES records: (download)

>d2vxjb_ b.18.1.16 (B:) PA-IL, galactose-binding lectin 1 {Pseudomonas aeruginosa [TaxId: 287]}
awkgevlanneagqvtsiiynpgdvitivaagwasygptqkwgpqgdrehpdqglichda
fcgalvmkignsgtipvntglfrwvapnnvqgaitliyndvpgtygnnsgsfsvnigkdq
s

Sequence, based on observed residues (ATOM records): (download)

>d2vxjb_ b.18.1.16 (B:) PA-IL, galactose-binding lectin 1 {Pseudomonas aeruginosa [TaxId: 287]}
awkgevlanneagqvtsiiynpgdvitivaagwasygptqkwgpqgdrehpdqglichda
fcgalvmkignsgtipvntglfrwvavqgaitliyndvpgtygnnsgsfsvnigkdqs

SCOPe Domain Coordinates for d2vxjb_:

Click to download the PDB-style file with coordinates for d2vxjb_.
(The format of our PDB-style files is described here.)

Timeline for d2vxjb_: