Lineage for d2vxfa_ (2vxf A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1786638Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 1786639Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 1787167Family b.38.1.5: LSM14 N-terminal domain-like [141297] (2 proteins)
    automatically mapped to Pfam PF14438
    automatically mapped to Pfam PF12701
  6. 1787171Protein automated matches [254634] (2 species)
    not a true protein
  7. 1787174Species Zebrafish (Danio rerio) [TaxId:7955] [255625] (1 PDB entry)
  8. 1787175Domain d2vxfa_: 2vxf A: [153679]
    automated match to d2vxfa1

Details for d2vxfa_

PDB Entry: 2vxf (more details)

PDB Description: solution structure of the lsm-domain of zebrafish rap55
PDB Compounds: (A:) lsm14a protein

SCOPe Domain Sequences for d2vxfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vxfa_ b.38.1.5 (A:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
ledpsggtpyigskisliskaeiryegilytidtenstvalakvrsfgtedrptdrpiap
rdetfeyiifrgsdikdltvceppkpim

SCOPe Domain Coordinates for d2vxfa_:

Click to download the PDB-style file with coordinates for d2vxfa_.
(The format of our PDB-style files is described here.)

Timeline for d2vxfa_: