SCOPe 2.04: Domain d2vxfa_: 2vxf A:

Lineage for d2vxfa_ (2vxf A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.38: Sm-like fold [50181] (5 superfamilies)
   core: barrel, open; n*=4, S*=8; meander; SH3-like topology

4. Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families)

5. Family b.38.1.5: LSM14 N-terminal domain-like [141297] (2 proteins)
   automatically mapped to Pfam PF14438
   automatically mapped to Pfam PF12701

6. Protein automated matches [254634] (2 species)
   not a true protein

7. Species Zebrafish (Danio rerio) [TaxId:7955] [255625] (1 PDB entry)

8. Domain d2vxfa_: 2vxf A: [153679]
   automated match to d2vxfa1

Details for d2vxfa_

PDB Entry: 2vxf

PDB Description: solution structure of the lsm-domain of zebrafish rap55

PDB Compounds: (A:) lsm14a protein

SCOPe Domain Sequences for d2vxfa_:

Sequence; same for both SEQRES and ATOM records:

>d2vxfa_ b.38.1.5 (A:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
ledpsggtpyigskisliskaeiryegilytidtenstvalakvrsfgtedrptdrpiap
rdetfeyiifrgsdikdltvceppkpim

Timeline for d2vxfa_:

• d2vxfa_ first appeared in SCOP 1.75, called d2vxfa1
  
• d2vxfa_ was called d2vxfa1 in SCOPe 2.03
  
• d2vxfa_ appears in SCOPe 2.05
  
• d2vxfa_ appears in the current release, SCOPe 2.08, called d2vxfa2