Lineage for d2vxfa1 (2vxf A:6-85)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1312761Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 1312762Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 1313223Family b.38.1.5: LSM14 N-terminal domain-like [141297] (1 protein)
    automatically mapped to Pfam PF14438
    automatically mapped to Pfam PF12701
  6. 1313224Protein LSM14 homolog A (Lsm14a) [141298] (1 species)
  7. 1313225Species Zebrafish (Danio rerio) [TaxId:7955] [141299] (2 PDB entries)
    Uniprot Q6P111 6-85
  8. 1313226Domain d2vxfa1: 2vxf A:6-85 [153679]
    automatically matched to d2fb7a1

Details for d2vxfa1

PDB Entry: 2vxf (more details)

PDB Description: solution structure of the lsm-domain of zebrafish rap55
PDB Compounds: (A:) lsm14a protein

SCOPe Domain Sequences for d2vxfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vxfa1 b.38.1.5 (A:6-85) LSM14 homolog A (Lsm14a) {Zebrafish (Danio rerio) [TaxId: 7955]}
pyigskisliskaeiryegilytidtenstvalakvrsfgtedrptdrpiaprdetfeyi
ifrgsdikdltvceppkpim

SCOPe Domain Coordinates for d2vxfa1:

Click to download the PDB-style file with coordinates for d2vxfa1.
(The format of our PDB-style files is described here.)

Timeline for d2vxfa1: