SCOPe 2.08: Domain d2vxfa2: 2vxf A:0-85

Lineage for d2vxfa2 (2vxf A:0-85)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.38: Sm-like fold [50181] (5 superfamilies)
   core: barrel, open; n*=4, S*=8; meander; SH3-like topology

4. Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families)

5. Family b.38.1.5: LSM14 N-terminal domain-like [141297] (2 proteins)
   automatically mapped to Pfam PF14438
   automatically mapped to Pfam PF12701

6. Protein automated matches [254634] (3 species)
   not a true protein

7. Species Zebrafish (Danio rerio) [TaxId:7955] [255625] (1 PDB entry)

8. Domain d2vxfa2: 2vxf A:0-85 [153679]
   Other proteins in same PDB: d2vxfa3
   automated match to d2vxfa1

Details for d2vxfa2

PDB Entry: 2vxf

PDB Description: solution structure of the lsm-domain of zebrafish rap55

PDB Compounds: (A:) lsm14a protein

SCOPe Domain Sequences for d2vxfa2:

Sequence; same for both SEQRES and ATOM records:

>d2vxfa2 b.38.1.5 (A:0-85) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
dpsggtpyigskisliskaeiryegilytidtenstvalakvrsfgtedrptdrpiaprd
etfeyiifrgsdikdltvceppkpim

Timeline for d2vxfa2:

• d2vxfa2 first appeared in SCOP 1.75, called d2vxfa1
  
• d2vxfa2 appears in SCOPe 2.07