Lineage for d2vwka2 (2vwk A:348-773)

  1. Root: SCOP 1.75
  2. 883176Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 884269Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 884270Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 884271Family e.8.1.1: DNA polymerase I [56673] (4 proteins)
  6. 884349Protein Family B DNA polymerase [56680] (7 species)
  7. 884356Species Archaeon Thermococcus gorgonarius [TaxId:71997] [56682] (3 PDB entries)
  8. 884358Domain d2vwka2: 2vwk A:348-773 [153678]
    Other proteins in same PDB: d2vwka1
    automatically matched to d1tgoa2
    complexed with na, so4; mutant

Details for d2vwka2

PDB Entry: 2vwk (more details), 2.6 Å

PDB Description: uracil recognition in archaeal dna polymerases captured by x-ray crystallography. v93q polymerase variant
PDB Compounds: (A:) DNA polymerase

SCOP Domain Sequences for d2vwka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vwka2 e.8.1.1 (A:348-773) Family B DNA polymerase {Archaeon Thermococcus gorgonarius [TaxId: 71997]}
stgnlvewfllrkayernelapnkpderelarrresyaggyvkeperglwenivyldfrs
lypsiiithnvspdtlnregceeydvapqvghkfckdfpgfipsllgdlleerqkvkkkm
katidpiekklldyrqraikilansfygyygyakarwyckecaesvtawgrqyiettire
ieekfgfkvlyadtdgffatipgadaetvkkkakefldyinaklpglleleyegfykrgf
fvtkkkyavideedkittrgleivrrdwseiaketqarvleailkhgdveeavrivkevt
eklskyevppeklviyeqitrdlkdykatgphvavakrlaargikirpgtvisyivlkgs
grigdraipfdefdpakhkydaeyyienqvlpaverilrafgyrkedlryqktrqvglga
wlkpkt

SCOP Domain Coordinates for d2vwka2:

Click to download the PDB-style file with coordinates for d2vwka2.
(The format of our PDB-style files is described here.)

Timeline for d2vwka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2vwka1