SCOPe 2.08: Domain d2vwka2: 2vwk A:348-773

Lineage for d2vwka2 (2vwk A:348-773)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.1: DNA polymerase I [56673] (5 proteins)
   in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
   

6. Protein automated matches [226972] (9 species)
   not a true protein

7. Species Thermococcus gorgonarius [TaxId:71997] [225934] (6 PDB entries)

8. Domain d2vwka2: 2vwk A:348-773 [153678]
   Other proteins in same PDB: d2vwka1
   automated match to d1tgoa2
   complexed with na, so4

Details for d2vwka2

PDB Entry: 2vwk, 2.6 Å

PDB Description: uracil recognition in archaeal dna polymerases captured by x-ray crystallography. v93q polymerase variant

PDB Compounds: (A:) DNA polymerase

SCOPe Domain Sequences for d2vwka2:

Sequence; same for both SEQRES and ATOM records:

>d2vwka2 e.8.1.1 (A:348-773) automated matches {Thermococcus gorgonarius [TaxId: 71997]}
stgnlvewfllrkayernelapnkpderelarrresyaggyvkeperglwenivyldfrs
lypsiiithnvspdtlnregceeydvapqvghkfckdfpgfipsllgdlleerqkvkkkm
katidpiekklldyrqraikilansfygyygyakarwyckecaesvtawgrqyiettire
ieekfgfkvlyadtdgffatipgadaetvkkkakefldyinaklpglleleyegfykrgf
fvtkkkyavideedkittrgleivrrdwseiaketqarvleailkhgdveeavrivkevt
eklskyevppeklviyeqitrdlkdykatgphvavakrlaargikirpgtvisyivlkgs
grigdraipfdefdpakhkydaeyyienqvlpaverilrafgyrkedlryqktrqvglga
wlkpkt

Timeline for d2vwka2:

• d2vwka2 first appeared in SCOP 1.75
  
• d2vwka2 appears in SCOPe 2.07