Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
Family e.8.1.1: DNA polymerase I [56673] (5 proteins) in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
Protein automated matches [226972] (9 species) not a true protein |
Species Thermococcus gorgonarius [TaxId:71997] [225934] (6 PDB entries) |
Domain d2vwka2: 2vwk A:348-773 [153678] Other proteins in same PDB: d2vwka1 automated match to d1tgoa2 complexed with na, so4 |
PDB Entry: 2vwk (more details), 2.6 Å
SCOPe Domain Sequences for d2vwka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vwka2 e.8.1.1 (A:348-773) automated matches {Thermococcus gorgonarius [TaxId: 71997]} stgnlvewfllrkayernelapnkpderelarrresyaggyvkeperglwenivyldfrs lypsiiithnvspdtlnregceeydvapqvghkfckdfpgfipsllgdlleerqkvkkkm katidpiekklldyrqraikilansfygyygyakarwyckecaesvtawgrqyiettire ieekfgfkvlyadtdgffatipgadaetvkkkakefldyinaklpglleleyegfykrgf fvtkkkyavideedkittrgleivrrdwseiaketqarvleailkhgdveeavrivkevt eklskyevppeklviyeqitrdlkdykatgphvavakrlaargikirpgtvisyivlkgs grigdraipfdefdpakhkydaeyyienqvlpaverilrafgyrkedlryqktrqvglga wlkpkt
Timeline for d2vwka2: