Lineage for d2vwja2 (2vwj A:348-757)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3016464Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 3016465Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 3016466Family e.8.1.1: DNA polymerase I [56673] (5 proteins)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 3016762Protein automated matches [226972] (9 species)
    not a true protein
  7. 3016807Species Thermococcus gorgonarius [TaxId:71997] [225934] (6 PDB entries)
  8. 3016812Domain d2vwja2: 2vwj A:348-757 [153676]
    Other proteins in same PDB: d2vwja1
    automated match to d1tgoa2
    complexed with k

Details for d2vwja2

PDB Entry: 2vwj (more details), 2.78 Å

PDB Description: uracil recognition in archaeal dna polymerases captured by x-ray crystallography.
PDB Compounds: (A:) DNA polymerase

SCOPe Domain Sequences for d2vwja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vwja2 e.8.1.1 (A:348-757) automated matches {Thermococcus gorgonarius [TaxId: 71997]}
stgnlvewfllrkayernelapnkpderelarrresyaggyvkeperglwenivyldfrs
lypsiiithnvspdtlnregceeydvapqvghkfckdfpgfipsllgdlleerqkvkkkm
katidpiekklldyrqraikilansfygyygyakarwyckecaesvtawgrqyiettire
ieekfgfkvlyadtdgffatipgadaetvkkkakefldyinaklpglleleyegfykrgf
fvtkkkyavideedkittrgleivrrdwseiaketqarvleailkhgdveeavrivkevt
eklskyevppeklviyeqitrdlkdykatgphvavakrlaargikirpgtvisyivlkgs
grigdraipfdefdpakhkydaeyyienqvlpaverilrafgyrkedlry

SCOPe Domain Coordinates for d2vwja2:

Click to download the PDB-style file with coordinates for d2vwja2.
(The format of our PDB-style files is described here.)

Timeline for d2vwja2: