SCOPe 2.08: Domain d2vwja1: 2vwj A:1-347

Lineage for d2vwja1 (2vwj A:1-347)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins)
   contains Pfam PF00929

6. Protein automated matches [190162] (6 species)
   not a true protein

7. Species Thermococcus gorgonarius [TaxId:71997] [225933] (6 PDB entries)

8. Domain d2vwja1: 2vwj A:1-347 [153675]
   Other proteins in same PDB: d2vwja2
   automated match to d1tgoa1
   complexed with k

Details for d2vwja1

PDB Entry: 2vwj, 2.78 Å

PDB Description: uracil recognition in archaeal dna polymerases captured by x-ray crystallography.

PDB Compounds: (A:) DNA polymerase

SCOPe Domain Sequences for d2vwja1:

Sequence; same for both SEQRES and ATOM records:

>d2vwja1 c.55.3.5 (A:1-347) automated matches {Thermococcus gorgonarius [TaxId: 71997]}
mildtdyitedgkpvirifkkengefkidydrnfepyiyallkddsaiedvkkitaerhg
ttvrvvraekvkkkflgrpievwklyfthpqdvpairdkikehpavvdiyeydipfakry
lidkglipmegdeelkmlafdietlyhegekfaegpilmisyadeegarvitwrnidlpy
vdvvstekemikrflkvvkekdpdvlityngdnfafaylkkrseklgvkfilgregsepk
iqrmgdrfavevkgrihfdlypvirrtinlptytleavyeaifgqpkekvyaeeiaqawe
tgeglervarysmedakvtyelgkeffpmeaqlsrlvgqslwdvsrs

Timeline for d2vwja1:

• d2vwja1 first appeared in SCOP 1.75
  
• d2vwja1 appears in SCOPe 2.07