Lineage for d2vw6b1 (2vw6 B:2-159)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2380192Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2380193Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2381028Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)
  6. 2381275Protein Nitrite reductase, NIR [49551] (5 species)
    consists of two domains of this fold
  7. 2381575Species Alcaligenes xylosoxidans [TaxId:85698] [49554] (24 PDB entries)
    Uniprot O68601 25-360 ! Uniprot O68601 26-359 ! Uniprot O68601
  8. 2381604Domain d2vw6b1: 2vw6 B:2-159 [153668]
    automated match to d1haua1
    complexed with cu, pg4, zn

Details for d2vw6b1

PDB Entry: 2vw6 (more details), 1.9 Å

PDB Description: nitrite reductase from alcaligenes xylosoxidans - 3 of 3
PDB Compounds: (B:) dissimilatory copper-containing nitrite reductase

SCOPe Domain Sequences for d2vw6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vw6b1 b.6.1.3 (B:2-159) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]}
dadklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfngs
mpgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfkad
rsgtfvyhcapegmvpwhvvsgmsgtlmvlprdglkdp

SCOPe Domain Coordinates for d2vw6b1:

Click to download the PDB-style file with coordinates for d2vw6b1.
(The format of our PDB-style files is described here.)

Timeline for d2vw6b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2vw6b2