SCOP 1.75: Domain d2vw6b1: 2vw6 B:3-159

Lineage for d2vw6b1 (2vw6 B:3-159)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (7 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)

6. Protein Nitrite reductase, NIR [49551] (5 species)
   consists of two domains of this fold

7. Species Alcaligenes xylosoxidans [TaxId:85698] [49554] (31 PDB entries)
   Uniprot O68601 25-360
   Uniprot O68601 26-359
   Uniprot O68601
   Uniprot O68601 25-360 ! Uniprot O68601 26-359 ! Uniprot O68601

8. Domain d2vw6b1: 2vw6 B:3-159 [153668]
   automatically matched to d1gs6x1
   complexed with cu, pg4, zn

Details for d2vw6b1

PDB Entry: 2vw6, 1.9 Å

PDB Description: nitrite reductase from alcaligenes xylosoxidans - 3 of 3

PDB Compounds: (B:) dissimilatory copper-containing nitrite reductase

SCOP Domain Sequences for d2vw6b1:

Sequence; same for both SEQRES and ATOM records:

>d2vw6b1 b.6.1.3 (B:3-159) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]}
adklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfngsm
pgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfkadr
sgtfvyhcapegmvpwhvvsgmsgtlmvlprdglkdp

Timeline for d2vw6b1:

• d2vw6b1 is new in SCOP 1.75
  
• d2vw6b1 appears in SCOPe 2.01
  
• d2vw6b1 appears in the current release, SCOPe 2.08