![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) |
![]() | Protein Nitrite reductase, NIR, N-terminal domain [418910] (5 species) |
![]() | Species Alcaligenes xylosoxidans [TaxId:85698] [419328] (24 PDB entries) Uniprot O68601 |
![]() | Domain d2vw4b1: 2vw4 B:3-159 [153660] Other proteins in same PDB: d2vw4a2, d2vw4b2 automated match to d1haua1 complexed with cu, pg4, zn |
PDB Entry: 2vw4 (more details), 1.9 Å
SCOPe Domain Sequences for d2vw4b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vw4b1 b.6.1.3 (B:3-159) Nitrite reductase, NIR, N-terminal domain {Alcaligenes xylosoxidans [TaxId: 85698]} adklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfngsm pgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfkadr sgtfvyhcapegmvpwhvvsgmsgtlmvlprdglkdp
Timeline for d2vw4b1: