SCOPe 2.05: Domain d2vvsa3: 2vvs A:5-126

Lineage for d2vvsa3 (2vvs A:5-126)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families)
   contains similar fold but lacks its catalytic centre

5. Family d.92.2.0: automated matches [227269] (1 protein)
   not a true family

6. Protein automated matches [227062] (4 species)
   not a true protein

7. Species Bacteroides thetaiotaomicron [TaxId:226186] [255267] (4 PDB entries)

8. Domain d2vvsa3: 2vvs A:5-126 [153657]
   Other proteins in same PDB: d2vvsa1, d2vvsa2
   automated match to d2vvna3
   complexed with oan

Details for d2vvsa3

PDB Entry: 2vvs, 2.24 Å

PDB Description: btgh84 structure in complex with pugnac

PDB Compounds: (A:) o-glcnacase bt_4395

SCOPe Domain Sequences for d2vvsa3:

Sequence, based on SEQRES records:

>d2vvsa3 d.92.2.0 (A:5-126) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
lqpppqqlivqnktidlpavyqlnggeeanphavkvlkellsgkqsskkgmlisigekgd
ksvrkysrqipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeveikdy
ps

Sequence, based on observed residues (ATOM records):

>d2vvsa3 d.92.2.0 (A:5-126) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
lqpppqqlivqnktidlpavyqlnggeeanphavkvlkellgmlisigekgdksvrkysr
qipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeveikdyps

Timeline for d2vvsa3:

• d2vvsa3 first appeared in SCOP 1.75
  
• d2vvsa3 appears in SCOPe 2.04
  
• d2vvsa3 appears in SCOPe 2.06
  
• d2vvsa3 appears in the current release, SCOPe 2.08