| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (3 families) ![]() contains similar fold but lacks its catalytic centre |
| Family d.92.2.3: Hyaluronidase N-terminal domain-like [143618] (2 proteins) |
| Protein Glucosaminidase GH84, N-terminal domain [143621] (1 species) |
| Species Bacteroides thetaiotaomicron [TaxId:818] [143622] (7 PDB entries) Uniprot Q89ZI2 25-147 |
| Domain d2vvsa3: 2vvs A:5-126 [153657] Other proteins in same PDB: d2vvsa1, d2vvsa2 automatically matched to 2J4G A:4-126 complexed with oan |
PDB Entry: 2vvs (more details), 2.24 Å
SCOP Domain Sequences for d2vvsa3:
Sequence, based on SEQRES records: (download)
>d2vvsa3 d.92.2.3 (A:5-126) Glucosaminidase GH84, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]}
lqpppqqlivqnktidlpavyqlnggeeanphavkvlkellsgkqsskkgmlisigekgd
ksvrkysrqipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeveikdy
ps
>d2vvsa3 d.92.2.3 (A:5-126) Glucosaminidase GH84, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]}
lqpppqqlivqnktidlpavyqlnggeeanphavkvlkellgmlisigekgdksvrkysr
qipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeveikdyps
Timeline for d2vvsa3: