Lineage for d2vvsa1 (2vvs A:437-592)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2343439Fold a.246: Hyaluronidase domain-like [140656] (3 superfamilies)
    5 helices; bundle, closed, left-handed twist; up-and-down (meander) topology
  4. 2343440Superfamily a.246.1: Hyaluronidase post-catalytic domain-like [140657] (2 families) (S)
  5. 2343472Family a.246.1.0: automated matches [254242] (1 protein)
    not a true family
  6. 2343473Protein automated matches [254554] (2 species)
    not a true protein
  7. 2343474Species Bacteroides thetaiotaomicron [TaxId:226186] [255269] (4 PDB entries)
  8. 2343479Domain d2vvsa1: 2vvs A:437-592 [153655]
    Other proteins in same PDB: d2vvsa2, d2vvsa3
    automated match to d2choa1
    complexed with oan

Details for d2vvsa1

PDB Entry: 2vvs (more details), 2.24 Å

PDB Description: btgh84 structure in complex with pugnac
PDB Compounds: (A:) o-glcnacase bt_4395

SCOPe Domain Sequences for d2vvsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vvsa1 a.246.1.0 (A:437-592) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
reesmdiqpaaerflkafkegknydkadfetlqytfermkesadillmntenkpliveit
pwvhqfkltaemgeevlkmvegrnesyflrkynhvkalqqqmfyidqtsnqnpyqpgvkt
atrvikplidrtfatvvkffnqkfnahldattdymp

SCOPe Domain Coordinates for d2vvsa1:

Click to download the PDB-style file with coordinates for d2vvsa1.
(The format of our PDB-style files is described here.)

Timeline for d2vvsa1: