SCOP 1.75: Domain d2vvpe1: 2vvp E:3-158

Lineage for d2vvpe1 (2vvp E:3-158)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily)
   3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase fold

4. Superfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (1 family)

5. Family c.121.1.1: Ribose/Galactose isomerase RpiB/AlsB [89624] (2 proteins)

6. Protein Alternate ribose 5-phosphate isomerase B, RpiB [89625] (2 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [102273] (6 PDB entries)
   Uniprot Q79FD7
   Rv2465c

8. Domain d2vvpe1: 2vvp E:3-158 [153649]
   automatically matched to d1uslc_
   complexed with 5rp, r52

Details for d2vvpe1

PDB Entry: 2vvp, 1.65 Å

PDB Description: crystal structure of mycobacterium tuberculosis ribose-5-phosphate isomerase b in complex with its substrates ribose 5-phosphate and ribulose 5-phosphate

PDB Compounds: (E:) ribose-5-phosphate isomerase b

SCOP Domain Sequences for d2vvpe1:

Sequence; same for both SEQRES and ATOM records:

>d2vvpe1 c.121.1.1 (E:3-158) Alternate ribose 5-phosphate isomerase B, RpiB {Mycobacterium tuberculosis [TaxId: 1773]}
gmrvylgadhagyelkqriiehlkqtghepidcgalrydadddypafciaaatrtvadpg
slgivlggsgngeqiaankvpgarcalawsvqtaalarehnnaqligiggrmhtvaeala
ivdafvttpwskaqrhqrridilaeyertheappvp

Timeline for d2vvpe1:

• d2vvpe1 is new in SCOP 1.75
  
• d2vvpe1 is called d2vvpe_ in SCOPe 2.01
  
• d2vvpe1 appears in the current release, SCOPe 2.08, called d2vvpe_