Lineage for d2vvnb3 (2vvn B:4-126)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2204982Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2206336Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families) (S)
    contains similar fold but lacks its catalytic centre
  5. 2206407Family d.92.2.3: Hyaluronidase N-terminal domain-like [143618] (2 proteins)
  6. 2206408Protein Glucosaminidase GH84, N-terminal domain [143621] (1 species)
  7. 2206409Species Bacteroides thetaiotaomicron [TaxId:818] [143622] (8 PDB entries)
    Uniprot Q89ZI2 25-147
  8. 2206413Domain d2vvnb3: 2vvn B:4-126 [153639]
    Other proteins in same PDB: d2vvna1, d2vvna2, d2vvnb1, d2vvnb2
    automatically matched to 2J4G A:4-126
    complexed with gol, nh4, nht

Details for d2vvnb3

PDB Entry: 2vvn (more details), 1.85 Å

PDB Description: btgh84 in complex with nh-butylthiazoline
PDB Compounds: (B:) o-glcnacase bt_4395

SCOPe Domain Sequences for d2vvnb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vvnb3 d.92.2.3 (B:4-126) Glucosaminidase GH84, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]}
slqpppqqlivqnktidlpavyqlnggeeanphavkvlkellsgkqsskkgmlisigekg
dksvrkysrqipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeveikd
yps

SCOPe Domain Coordinates for d2vvnb3:

Click to download the PDB-style file with coordinates for d2vvnb3.
(The format of our PDB-style files is described here.)

Timeline for d2vvnb3: