SCOPe 2.08: Domain d2vvnb3: 2vvn B:4-126

Lineage for d2vvnb3 (2vvn B:4-126)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families)
   contains similar fold but lacks its catalytic centre

5. Family d.92.2.3: Hyaluronidase N-terminal domain-like [143618] (2 proteins)

6. Protein Glucosaminidase GH84, N-terminal domain [143621] (1 species)

7. Species Bacteroides thetaiotaomicron [TaxId:818] [143622] (8 PDB entries)
   Uniprot Q89ZI2 25-147

8. Domain d2vvnb3: 2vvn B:4-126 [153639]
   Other proteins in same PDB: d2vvna1, d2vvna2, d2vvnb1, d2vvnb2
   automatically matched to 2J4G A:4-126
   complexed with gol, nh4, nht

Details for d2vvnb3

PDB Entry: 2vvn, 1.85 Å

PDB Description: btgh84 in complex with nh-butylthiazoline

PDB Compounds: (B:) o-glcnacase bt_4395

SCOPe Domain Sequences for d2vvnb3:

Sequence; same for both SEQRES and ATOM records:

>d2vvnb3 d.92.2.3 (B:4-126) Glucosaminidase GH84, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]}
slqpppqqlivqnktidlpavyqlnggeeanphavkvlkellsgkqsskkgmlisigekg
dksvrkysrqipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeveikd
yps

Timeline for d2vvnb3:

• d2vvnb3 first appeared in SCOP 1.75
  
• d2vvnb3 appears in SCOPe 2.07