| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
| Family c.1.8.10: alpha-D-glucuronidase/Hyaluronidase catalytic domain [82253] (4 proteins) Glycosyl hydrolase family 67, GH67; structurally related to GH20; contains extra C-terminal alpha-helical subdomain |
| Protein Glucosaminidase GH84, catalytic domain [141790] (1 species) |
| Species Bacteroides thetaiotaomicron [TaxId:818] [141791] (8 PDB entries) Uniprot Q89ZI2 148-457 |
| Domain d2vvnb2: 2vvn B:127-436 [153638] Other proteins in same PDB: d2vvna1, d2vvna3, d2vvnb1, d2vvnb3 automatically matched to 2J4G A:127-436 complexed with gol, nh4, nht |
PDB Entry: 2vvn (more details), 1.85 Å
SCOPe Domain Sequences for d2vvnb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vvnb2 c.1.8.10 (B:127-436) Glucosaminidase GH84, catalytic domain {Bacteroides thetaiotaomicron [TaxId: 818]}
vryrgvvegfygtpwshqarlsqlkfygknkmntyiygpkddpyhsapnwrlpypdkeaa
qlqelvavanenevdfvwaihpgqdikwnkedrdlllakfekmyqlgvrsfavffddisg
egtnpqkqaellnyidekfaqvkpdinqlvmcpteynkswsnpngnylttlgdklnpsiq
imwtgdrvisditrdgiswinerikrpayiwwnfpvsdyvrdhlllgpvygndttiakem
sgfvtnpmehaesskiaiysvasyawnpakydtwqtwkdairtilpsaaeelecfamhns
dlgpnghgyr
Timeline for d2vvnb2: