SCOPe 2.08: Domain d2vvnb2: 2vvn B:127-436

Lineage for d2vvnb2 (2vvn B:127-436)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.10: alpha-D-glucuronidase/Hyaluronidase catalytic domain [82253] (4 proteins)
   Glycosyl hydrolase family 67, GH67; structurally related to GH20; contains extra C-terminal alpha-helical subdomain

6. Protein Glucosaminidase GH84, catalytic domain [141790] (1 species)

7. Species Bacteroides thetaiotaomicron [TaxId:818] [141791] (8 PDB entries)
   Uniprot Q89ZI2 148-457

8. Domain d2vvnb2: 2vvn B:127-436 [153638]
   Other proteins in same PDB: d2vvna1, d2vvna3, d2vvnb1, d2vvnb3
   automatically matched to 2J4G A:127-436
   complexed with gol, nh4, nht

Details for d2vvnb2

PDB Entry: 2vvn, 1.85 Å

PDB Description: btgh84 in complex with nh-butylthiazoline

PDB Compounds: (B:) o-glcnacase bt_4395

SCOPe Domain Sequences for d2vvnb2:

Sequence; same for both SEQRES and ATOM records:

>d2vvnb2 c.1.8.10 (B:127-436) Glucosaminidase GH84, catalytic domain {Bacteroides thetaiotaomicron [TaxId: 818]}
vryrgvvegfygtpwshqarlsqlkfygknkmntyiygpkddpyhsapnwrlpypdkeaa
qlqelvavanenevdfvwaihpgqdikwnkedrdlllakfekmyqlgvrsfavffddisg
egtnpqkqaellnyidekfaqvkpdinqlvmcpteynkswsnpngnylttlgdklnpsiq
imwtgdrvisditrdgiswinerikrpayiwwnfpvsdyvrdhlllgpvygndttiakem
sgfvtnpmehaesskiaiysvasyawnpakydtwqtwkdairtilpsaaeelecfamhns
dlgpnghgyr

Timeline for d2vvnb2:

• d2vvnb2 first appeared in SCOP 1.75
  
• d2vvnb2 appears in SCOPe 2.07