SCOPe 2.08: Domain d2vvna1: 2vvn A:437-589

Lineage for d2vvna1 (2vvn A:437-589)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.246: Hyaluronidase domain-like [140656] (3 superfamilies)
   5 helices; bundle, closed, left-handed twist; up-and-down (meander) topology

4. Superfamily a.246.1: Hyaluronidase post-catalytic domain-like [140657] (2 families)

5. Family a.246.1.1: Hyaluronidase post-catalytic domain-like [140658] (2 proteins)

6. Protein Glucosaminidase GH84 post-catalytic domain [140661] (1 species)

7. Species Bacteroides thetaiotaomicron [TaxId:818] [140662] (8 PDB entries)
   Uniprot Q89ZI2 458-610! Uniprot Q89ZI2 458-611

8. Domain d2vvna1: 2vvn A:437-589 [153634]
   Other proteins in same PDB: d2vvna2, d2vvna3, d2vvnb2, d2vvnb3
   automatically matched to 2J4G A:437-589
   complexed with gol, nh4, nht

Details for d2vvna1

PDB Entry: 2vvn, 1.85 Å

PDB Description: btgh84 in complex with nh-butylthiazoline

PDB Compounds: (A:) o-glcnacase bt_4395

SCOPe Domain Sequences for d2vvna1:

Sequence; same for both SEQRES and ATOM records:

>d2vvna1 a.246.1.1 (A:437-589) Glucosaminidase GH84 post-catalytic domain {Bacteroides thetaiotaomicron [TaxId: 818]}
reesmdiqpaaerflkafkegknydkadfetlqytfermkesadillmntenkpliveit
pwvhqfkltaemgeevlkmvegrnesyflrkynhvkalqqqmfyidqtsnqnpyqpgvkt
atrvikplidrtfatvvkffnqkfnahldattd

Timeline for d2vvna1:

• d2vvna1 first appeared in SCOP 1.75
  
• d2vvna1 appears in SCOPe 2.07