SCOPe 2.03: Domain d2vv5a3: 2vv5 A:27-112

Lineage for d2vv5a3 (2vv5 A:27-112)

1. Root: SCOPe 2.03

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.34: Mechanosensitive channel protein MscS (YggB), transmembrane region [82860] (1 superfamily)
   oligomeric fold; 3 transmembrane helices per subunit

4. Superfamily f.34.1: Mechanosensitive channel protein MscS (YggB), transmembrane region [82861] (1 family)

5. Family f.34.1.1: Mechanosensitive channel protein MscS (YggB), transmembrane region [82862] (1 protein)

6. Protein Mechanosensitive channel protein MscS (YggB), transmembrane region [82863] (1 species)
   homoheptameric protein

7. Species Escherichia coli [TaxId:562] [82864] (2 PDB entries)

8. Domain d2vv5a3: 2vv5 A:27-112 [153615]
   Other proteins in same PDB: d2vv5a1, d2vv5a2, d2vv5b1, d2vv5b2, d2vv5c1, d2vv5c2, d2vv5d1, d2vv5d2, d2vv5e1, d2vv5e2, d2vv5f1, d2vv5f2, d2vv5g1, d2vv5g2
   automatically matched to d2oaua3

Details for d2vv5a3

PDB Entry: 2vv5, 3.45 Å

PDB Description: the open structure of mscs

PDB Compounds: (A:) Small-conductance mechanosensitive channel

SCOPe Domain Sequences for d2vv5a3:

Sequence; same for both SEQRES and ATOM records:

>d2vv5a3 f.34.1.1 (A:27-112) Mechanosensitive channel protein MscS (YggB), transmembrane region {Escherichia coli [TaxId: 562]}
yavnivaalaiiivgliiarmisnavnrlmisrkidatvadflsalvrygiiaftliaal
grvgvqtasviavlgaaglvvglalq

Timeline for d2vv5a3:

• d2vv5a3 first appeared in SCOP 1.75
  
• d2vv5a3 appears in SCOPe 2.02
  
• d2vv5a3 appears in SCOPe 2.04
  
• d2vv5a3 appears in the current release, SCOPe 2.08