Class a: All alpha proteins [46456] (286 folds) |
Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) |
Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins) |
Protein automated matches [190059] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187214] (138 PDB entries) |
Domain d2vv0b_: 2vv0 B: [153606] automated match to d1wm0x_ protein/DNA complex; complexed with hxa |
PDB Entry: 2vv0 (more details), 2.55 Å
SCOPe Domain Sequences for d2vv0b_:
Sequence, based on SEQRES records: (download)
>d2vv0b_ a.123.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} sadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkhi tplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiy tmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaif iaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivt ehvqllqvikktetdmslhpllqeiykdl
>d2vv0b_ a.123.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} sadlralakhlydsyiksfpltkakarailtgkdkspfviydmnslmmgedkikkevair ifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkdgvl isegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdrpgl lnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvikkte thpllqeiykdl
Timeline for d2vv0b_: