![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
![]() | Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (18 families) ![]() |
![]() | Family g.39.1.1: Erythroid transcription factor GATA-1 [57717] (1 protein) single zinc-binding motif |
![]() | Protein Erythroid transcription factor GATA-1 [57718] (3 species) |
![]() | Species Emericella nidulans [TaxId:162425] [161161] (3 PDB entries) |
![]() | Domain d2vuuo1: 2vuu O:671-711 [153603] Other proteins in same PDB: d2vuua1, d2vuub1, d2vuuc1, d2vuud1, d2vuue1, d2vuuf1, d2vuug1, d2vuuh1 automatically matched to d4gata_ complexed with nap, zn |
PDB Entry: 2vuu (more details), 2.8 Å
SCOP Domain Sequences for d2vuuo1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vuuo1 g.39.1.1 (O:671-711) Erythroid transcription factor GATA-1 {Emericella nidulans [TaxId: 162425]} ttctncftqttplwrrnpegqplcnacglflklhgvvrpls
Timeline for d2vuuo1: