Lineage for d2vuul_ (2vuu L:)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1463401Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 1463402Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 1463917Family g.39.1.0: automated matches [191378] (1 protein)
    not a true family
  6. 1463918Protein automated matches [190463] (4 species)
    not a true protein
  7. 1463923Species Emericella nidulans [TaxId:162425] [225494] (3 PDB entries)
  8. 1463943Domain d2vuul_: 2vuu L: [153600]
    Other proteins in same PDB: d2vuua_, d2vuub_, d2vuuc_, d2vuud_, d2vuue_, d2vuuf_, d2vuug_, d2vuuh_
    automated match to d1gnfa_
    protein/DNA complex; complexed with nap, zn

Details for d2vuul_

PDB Entry: 2vuu (more details), 2.8 Å

PDB Description: crystal structure of nadp-bound nmra-area zinc finger complex
PDB Compounds: (L:) nitrogen regulatory protein area

SCOPe Domain Sequences for d2vuul_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vuul_ g.39.1.0 (L:) automated matches {Emericella nidulans [TaxId: 162425]}
ttctncftqttplwrrnpegqplcnacglflklhgvvrplsl

SCOPe Domain Coordinates for d2vuul_:

Click to download the PDB-style file with coordinates for d2vuul_.
(The format of our PDB-style files is described here.)

Timeline for d2vuul_: