Lineage for d2vuul1 (2vuu L:671-712)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1244274Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 1244275Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 1244276Family g.39.1.1: Erythroid transcription factor GATA-1 [57717] (2 proteins)
    single zinc-binding motif
  6. 1244277Protein Erythroid transcription factor GATA-1 [57718] (3 species)
  7. 1244287Species Emericella nidulans [TaxId:162425] [161161] (3 PDB entries)
  8. 1244307Domain d2vuul1: 2vuu L:671-712 [153600]
    Other proteins in same PDB: d2vuua_, d2vuub_, d2vuuc_, d2vuud_, d2vuue_, d2vuuf_, d2vuug_, d2vuuh_
    automatically matched to d4gata_
    protein/DNA complex; complexed with nap, zn

Details for d2vuul1

PDB Entry: 2vuu (more details), 2.8 Å

PDB Description: crystal structure of nadp-bound nmra-area zinc finger complex
PDB Compounds: (L:) nitrogen regulatory protein area

SCOPe Domain Sequences for d2vuul1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vuul1 g.39.1.1 (L:671-712) Erythroid transcription factor GATA-1 {Emericella nidulans [TaxId: 162425]}
ttctncftqttplwrrnpegqplcnacglflklhgvvrplsl

SCOPe Domain Coordinates for d2vuul1:

Click to download the PDB-style file with coordinates for d2vuul1.
(The format of our PDB-style files is described here.)

Timeline for d2vuul1: