Class g: Small proteins [56992] (90 folds) |
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) |
Family g.39.1.1: Erythroid transcription factor GATA-1 [57717] (2 proteins) single zinc-binding motif |
Protein Erythroid transcription factor GATA-1 [57718] (3 species) |
Species Emericella nidulans [TaxId:162425] [161161] (3 PDB entries) |
Domain d2vuul1: 2vuu L:671-712 [153600] Other proteins in same PDB: d2vuua_, d2vuub_, d2vuuc_, d2vuud_, d2vuue_, d2vuuf_, d2vuug_, d2vuuh_ automatically matched to d4gata_ protein/DNA complex; complexed with nap, zn |
PDB Entry: 2vuu (more details), 2.8 Å
SCOPe Domain Sequences for d2vuul1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vuul1 g.39.1.1 (L:671-712) Erythroid transcription factor GATA-1 {Emericella nidulans [TaxId: 162425]} ttctncftqttplwrrnpegqplcnacglflklhgvvrplsl
Timeline for d2vuul1: