Class g: Small proteins [56992] (98 folds) |
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) |
Family g.39.1.0: automated matches [191378] (1 protein) not a true family |
Protein automated matches [190463] (9 species) not a true protein |
Species Emericella nidulans [TaxId:162425] [225494] (3 PDB entries) |
Domain d2vuuj_: 2vuu J: [153598] Other proteins in same PDB: d2vuua_, d2vuub_, d2vuuc_, d2vuud_, d2vuue_, d2vuuf_, d2vuug_, d2vuuh_ automated match to d1gnfa_ protein/DNA complex; complexed with nap, zn |
PDB Entry: 2vuu (more details), 2.8 Å
SCOPe Domain Sequences for d2vuuj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vuuj_ g.39.1.0 (J:) automated matches {Emericella nidulans [TaxId: 162425]} ttctncftqttplwrrnpegqplcnacglflklhgvvrplsl
Timeline for d2vuuj_: