Lineage for d2vuuj_ (2vuu J:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035586Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 3035587Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 3036144Family g.39.1.0: automated matches [191378] (1 protein)
    not a true family
  6. 3036145Protein automated matches [190463] (9 species)
    not a true protein
  7. 3036150Species Emericella nidulans [TaxId:162425] [225494] (3 PDB entries)
  8. 3036168Domain d2vuuj_: 2vuu J: [153598]
    Other proteins in same PDB: d2vuua_, d2vuub_, d2vuuc_, d2vuud_, d2vuue_, d2vuuf_, d2vuug_, d2vuuh_
    automated match to d1gnfa_
    protein/DNA complex; complexed with nap, zn

Details for d2vuuj_

PDB Entry: 2vuu (more details), 2.8 Å

PDB Description: crystal structure of nadp-bound nmra-area zinc finger complex
PDB Compounds: (J:) nitrogen regulatory protein area

SCOPe Domain Sequences for d2vuuj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vuuj_ g.39.1.0 (J:) automated matches {Emericella nidulans [TaxId: 162425]}
ttctncftqttplwrrnpegqplcnacglflklhgvvrplsl

SCOPe Domain Coordinates for d2vuuj_:

Click to download the PDB-style file with coordinates for d2vuuj_.
(The format of our PDB-style files is described here.)

Timeline for d2vuuj_: