Lineage for d2vuui1 (2vuu I:671-712)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 892407Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 892408Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (18 families) (S)
  5. 892409Family g.39.1.1: Erythroid transcription factor GATA-1 [57717] (1 protein)
    single zinc-binding motif
  6. 892410Protein Erythroid transcription factor GATA-1 [57718] (3 species)
  7. 892420Species Emericella nidulans [TaxId:162425] [161161] (3 PDB entries)
  8. 892437Domain d2vuui1: 2vuu I:671-712 [153597]
    Other proteins in same PDB: d2vuua1, d2vuub1, d2vuuc1, d2vuud1, d2vuue1, d2vuuf1, d2vuug1, d2vuuh1
    automatically matched to d4gata_
    complexed with nap, zn

Details for d2vuui1

PDB Entry: 2vuu (more details), 2.8 Å

PDB Description: crystal structure of nadp-bound nmra-area zinc finger complex
PDB Compounds: (I:) nitrogen regulatory protein area

SCOP Domain Sequences for d2vuui1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vuui1 g.39.1.1 (I:671-712) Erythroid transcription factor GATA-1 {Emericella nidulans [TaxId: 162425]}
ttctncftqttplwrrnpegqplcnacglflklhgvvrplsl

SCOP Domain Coordinates for d2vuui1:

Click to download the PDB-style file with coordinates for d2vuui1.
(The format of our PDB-style files is described here.)

Timeline for d2vuui1: