Lineage for d2vuuh1 (2vuu H:3-352)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 819418Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 819419Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 819736Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 820494Protein Negative transcriptional regulator NmrA [69407] (1 species)
    has an UDP-galactose 4-epimerase-like structure but evolved a different function
  7. 820495Species Aspergillus nidulans [TaxId:162425] [69408] (8 PDB entries)
    Uniprot O59919
  8. 820525Domain d2vuuh1: 2vuu H:3-352 [153596]
    Other proteins in same PDB: d2vuui1, d2vuuj1, d2vuuk1, d2vuul1, d2vuum1, d2vuun1, d2vuuo1, d2vuup1
    automatically matched to d1k6jb_
    complexed with nap, zn

Details for d2vuuh1

PDB Entry: 2vuu (more details), 2.8 Å

PDB Description: crystal structure of nadp-bound nmra-area zinc finger complex
PDB Compounds: (H:) nitrogen metabolite repression regulator nmra

SCOP Domain Sequences for d2vuuh1:

Sequence, based on SEQRES records: (download)

>d2vuuh1 c.2.1.2 (H:3-352) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]}
qqkktiavvnatgrqaaslirvaaavghhvraqvhslkgliaeelqaipnvtlfqgplln
nvplmdtlfegahlafinttsqagdeiaigkdladaakragtiqhyiyssmpdhslygpw
pavpmwapkftvenyvrqlglpstfvyagiynnnftslpyplfqmelmpdgtfewhapfd
pdiplpwldaehdvgpallqifkdgpqkwnghrialtfetlspvqvcaafsralnrrvty
vqvpkveikvnipvgyreqleaievvfgehkapyfplpefsrpaagspkglgpangkgag
agmmqgpggvisqrvtdearklwsgwrdmeeyarevfpieeeangldwml

Sequence, based on observed residues (ATOM records): (download)

>d2vuuh1 c.2.1.2 (H:3-352) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]}
qqkktiavvnatgrqaaslirvaaavghhvraqvhslkgliaeelqaipnvtlfqgplln
nvplmdtlfegahlafinttsqagdeiaigkdladaakragtiqhyiyssmpdhslygpw
pavpmwapkftvenyvrqlglpstfvyagiynnnftslpyplfqmelmpdgtfewhapfd
pdiplpwldaehdvgpallqifkdgpqkwnghrialtfetlspvqvcaafsralnrrvty
vqvpkveikvnipvgyreqleaievvfgehkapyfplpefsqrvtdearklwsgwrdmee
yarevfpieeeangldwml

SCOP Domain Coordinates for d2vuuh1:

Click to download the PDB-style file with coordinates for d2vuuh1.
(The format of our PDB-style files is described here.)

Timeline for d2vuuh1: