![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) ![]() |
![]() | Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 |
![]() | Protein Negative transcriptional regulator NmrA [69407] (1 species) has an UDP-galactose 4-epimerase-like structure but evolved a different function |
![]() | Species Aspergillus nidulans [TaxId:162425] [69408] (8 PDB entries) Uniprot O59919 |
![]() | Domain d2vuub1: 2vuu B:3-352 [153590] Other proteins in same PDB: d2vuui1, d2vuuj1, d2vuuk1, d2vuul1, d2vuum1, d2vuun1, d2vuuo1, d2vuup1 automatically matched to d1k6jb_ complexed with nap, zn |
PDB Entry: 2vuu (more details), 2.8 Å
SCOP Domain Sequences for d2vuub1:
Sequence, based on SEQRES records: (download)
>d2vuub1 c.2.1.2 (B:3-352) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} qqkktiavvnatgrqaaslirvaaavghhvraqvhslkgliaeelqaipnvtlfqgplln nvplmdtlfegahlafinttsqagdeiaigkdladaakragtiqhyiyssmpdhslygpw pavpmwapkftvenyvrqlglpstfvyagiynnnftslpyplfqmelmpdgtfewhapfd pdiplpwldaehdvgpallqifkdgpqkwnghrialtfetlspvqvcaafsralnrrvty vqvpkveikvnipvgyreqleaievvfgehkapyfplpefsrpaagspkglgpangkgag agmmqgpggvisqrvtdearklwsgwrdmeeyarevfpieeeangldwml
>d2vuub1 c.2.1.2 (B:3-352) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} qqkktiavvnatgrqaaslirvaaavghhvraqvhslkgliaeelqaipnvtlfqgplln nvplmdtlfegahlafinttsqagdeiaigkdladaakragtiqhyiyssmpdhslygpw pavpmwapkftvenyvrqlglpstfvyagiynnnftslpyplfqmelmpdgtfewhapfd pdiplpwldaehdvgpallqifkdgpqkwnghrialtfetlspvqvcaafsralnrrvty vqvpkveikvnipvgyreqleaievvfgehkapyfplpefsrrvtdearklwsgwrdmee yarevfpieeeangldwml
Timeline for d2vuub1: