Lineage for d2vutp_ (2vut P:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1965176Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 1965177Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 1965711Family g.39.1.0: automated matches [191378] (1 protein)
    not a true family
  6. 1965712Protein automated matches [190463] (6 species)
    not a true protein
  7. 1965717Species Emericella nidulans [TaxId:162425] [225494] (3 PDB entries)
  8. 1965725Domain d2vutp_: 2vut P: [153588]
    Other proteins in same PDB: d2vuta_, d2vutb_, d2vutc_, d2vutd_, d2vute_, d2vutf_, d2vutg_, d2vuth_
    automated match to d1gnfa_
    protein/DNA complex; complexed with cl, gol, nad, zn

Details for d2vutp_

PDB Entry: 2vut (more details), 2.3 Å

PDB Description: crystal structure of nad-bound nmra-area zinc finger complex
PDB Compounds: (P:) nitrogen regulatory protein area

SCOPe Domain Sequences for d2vutp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vutp_ g.39.1.0 (P:) automated matches {Emericella nidulans [TaxId: 162425]}
ttctncftqttplwrrnpegqplcnacglflklhgvvrplsl

SCOPe Domain Coordinates for d2vutp_:

Click to download the PDB-style file with coordinates for d2vutp_.
(The format of our PDB-style files is described here.)

Timeline for d2vutp_: