![]() | Class g: Small proteins [56992] (98 folds) |
![]() | Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
![]() | Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) ![]() |
![]() | Family g.39.1.0: automated matches [191378] (1 protein) not a true family |
![]() | Protein automated matches [190463] (9 species) not a true protein |
![]() | Species Emericella nidulans [TaxId:162425] [225494] (3 PDB entries) |
![]() | Domain d2vutn_: 2vut N: [153586] Other proteins in same PDB: d2vuta_, d2vutb_, d2vutc_, d2vutd_, d2vute_, d2vutf_, d2vutg_, d2vuth_ automated match to d1gnfa_ protein/DNA complex; complexed with cl, gol, nad, zn |
PDB Entry: 2vut (more details), 2.3 Å
SCOPe Domain Sequences for d2vutn_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vutn_ g.39.1.0 (N:) automated matches {Emericella nidulans [TaxId: 162425]} ttctncftqttplwrrnpegqplcnacglflklhgvvrplsl
Timeline for d2vutn_: