Lineage for d2vutn1 (2vut N:671-712)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1065411Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 1065412Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 1065413Family g.39.1.1: Erythroid transcription factor GATA-1 [57717] (2 proteins)
    single zinc-binding motif
  6. 1065414Protein Erythroid transcription factor GATA-1 [57718] (3 species)
  7. 1065424Species Emericella nidulans [TaxId:162425] [161161] (3 PDB entries)
  8. 1065430Domain d2vutn1: 2vut N:671-712 [153586]
    Other proteins in same PDB: d2vuta_, d2vutb_, d2vutc_, d2vutd_, d2vute_, d2vutf_, d2vutg_, d2vuth_
    automatically matched to d4gata_
    protein/DNA complex; complexed with cl, gol, nad, zn

Details for d2vutn1

PDB Entry: 2vut (more details), 2.3 Å

PDB Description: crystal structure of nad-bound nmra-area zinc finger complex
PDB Compounds: (N:) nitrogen regulatory protein area

SCOPe Domain Sequences for d2vutn1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vutn1 g.39.1.1 (N:671-712) Erythroid transcription factor GATA-1 {Emericella nidulans [TaxId: 162425]}
ttctncftqttplwrrnpegqplcnacglflklhgvvrplsl

SCOPe Domain Coordinates for d2vutn1:

Click to download the PDB-style file with coordinates for d2vutn1.
(The format of our PDB-style files is described here.)

Timeline for d2vutn1: