Lineage for d2vutm_ (2vut M:)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1463401Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 1463402Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 1463917Family g.39.1.0: automated matches [191378] (1 protein)
    not a true family
  6. 1463918Protein automated matches [190463] (4 species)
    not a true protein
  7. 1463923Species Emericella nidulans [TaxId:162425] [225494] (3 PDB entries)
  8. 1463928Domain d2vutm_: 2vut M: [153585]
    Other proteins in same PDB: d2vuta_, d2vutb_, d2vutc_, d2vutd_, d2vute_, d2vutf_, d2vutg_, d2vuth_
    automated match to d1gnfa_
    protein/DNA complex; complexed with cl, gol, nad, zn

Details for d2vutm_

PDB Entry: 2vut (more details), 2.3 Å

PDB Description: crystal structure of nad-bound nmra-area zinc finger complex
PDB Compounds: (M:) nitrogen regulatory protein area

SCOPe Domain Sequences for d2vutm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vutm_ g.39.1.0 (M:) automated matches {Emericella nidulans [TaxId: 162425]}
ttctncftqttplwrrnpegqplcnacglflklhgvvrplsl

SCOPe Domain Coordinates for d2vutm_:

Click to download the PDB-style file with coordinates for d2vutm_.
(The format of our PDB-style files is described here.)

Timeline for d2vutm_: