| Class g: Small proteins [56992] (100 folds) |
| Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) ![]() |
| Family g.39.1.0: automated matches [191378] (1 protein) not a true family |
| Protein automated matches [190463] (9 species) not a true protein |
| Species Emericella nidulans [TaxId:162425] [225494] (3 PDB entries) |
| Domain d2vutm_: 2vut M: [153585] Other proteins in same PDB: d2vuta_, d2vutb_, d2vutc_, d2vutd_, d2vute_, d2vutf_, d2vutg_, d2vuth_ automated match to d1gnfa_ protein/DNA complex; complexed with cl, gol, nad, zn |
PDB Entry: 2vut (more details), 2.3 Å
SCOPe Domain Sequences for d2vutm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vutm_ g.39.1.0 (M:) automated matches {Emericella nidulans [TaxId: 162425]}
ttctncftqttplwrrnpegqplcnacglflklhgvvrplsl
Timeline for d2vutm_: