SCOPe 2.01: Domain d2vutl1: 2vut L:671-712

Lineage for d2vutl1 (2vut L:671-712)

1. Root: SCOPe 2.01

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)

5. Family g.39.1.1: Erythroid transcription factor GATA-1 [57717] (2 proteins)
   single zinc-binding motif

6. Protein Erythroid transcription factor GATA-1 [57718] (3 species)

7. Species Emericella nidulans [TaxId:162425] [161161] (3 PDB entries)

8. Domain d2vutl1: 2vut L:671-712 [153584]
   Other proteins in same PDB: d2vuta_, d2vutb_, d2vutc_, d2vutd_, d2vute_, d2vutf_, d2vutg_, d2vuth_
   automatically matched to d4gata_
   protein/DNA complex; complexed with cl, gol, nad, zn

Details for d2vutl1

PDB Entry: 2vut, 2.3 Å

PDB Description: crystal structure of nad-bound nmra-area zinc finger complex

PDB Compounds: (L:) nitrogen regulatory protein area

SCOPe Domain Sequences for d2vutl1:

Sequence; same for both SEQRES and ATOM records:

>d2vutl1 g.39.1.1 (L:671-712) Erythroid transcription factor GATA-1 {Emericella nidulans [TaxId: 162425]}
ttctncftqttplwrrnpegqplcnacglflklhgvvrplsl

Timeline for d2vutl1:

• d2vutl1 first appeared in SCOP 1.75
  
• d2vutl1 appears in SCOPe 2.02
  
• d2vutl1 appears in the current release, SCOPe 2.08, called d2vutl_