Class g: Small proteins [56992] (98 folds) |
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) |
Family g.39.1.0: automated matches [191378] (1 protein) not a true family |
Protein automated matches [190463] (9 species) not a true protein |
Species Emericella nidulans [TaxId:162425] [225494] (3 PDB entries) |
Domain d2vusm_: 2vus M: [153569] Other proteins in same PDB: d2vusa_, d2vusb_, d2vusc_, d2vusd_, d2vuse_, d2vusf_, d2vusg_, d2vush_ automated match to d1gnfa_ protein/DNA complex; complexed with cl, so4, zn |
PDB Entry: 2vus (more details), 2.6 Å
SCOPe Domain Sequences for d2vusm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vusm_ g.39.1.0 (M:) automated matches {Emericella nidulans [TaxId: 162425]} pttctncftqttplwrrnpegqplcnacglflklhgvvrplsl
Timeline for d2vusm_: