Lineage for d2vusm_ (2vus M:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2640292Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 2640293Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 2640848Family g.39.1.0: automated matches [191378] (1 protein)
    not a true family
  6. 2640849Protein automated matches [190463] (9 species)
    not a true protein
  7. 2640854Species Emericella nidulans [TaxId:162425] [225494] (3 PDB entries)
  8. 2640867Domain d2vusm_: 2vus M: [153569]
    Other proteins in same PDB: d2vusa_, d2vusb_, d2vusc_, d2vusd_, d2vuse_, d2vusf_, d2vusg_, d2vush_
    automated match to d1gnfa_
    protein/DNA complex; complexed with cl, so4, zn

Details for d2vusm_

PDB Entry: 2vus (more details), 2.6 Å

PDB Description: crystal structure of unliganded nmra-area zinc finger complex
PDB Compounds: (M:) nitrogen regulatory protein area

SCOPe Domain Sequences for d2vusm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vusm_ g.39.1.0 (M:) automated matches {Emericella nidulans [TaxId: 162425]}
pttctncftqttplwrrnpegqplcnacglflklhgvvrplsl

SCOPe Domain Coordinates for d2vusm_:

Click to download the PDB-style file with coordinates for d2vusm_.
(The format of our PDB-style files is described here.)

Timeline for d2vusm_: