Lineage for d2vusk_ (2vus K:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2262247Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 2262248Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 2262786Family g.39.1.0: automated matches [191378] (1 protein)
    not a true family
  6. 2262787Protein automated matches [190463] (7 species)
    not a true protein
  7. 2262792Species Emericella nidulans [TaxId:162425] [225494] (3 PDB entries)
  8. 2262803Domain d2vusk_: 2vus K: [153567]
    Other proteins in same PDB: d2vusa_, d2vusb_, d2vusc_, d2vusd_, d2vuse_, d2vusf_, d2vusg_, d2vush_
    automated match to d1gnfa_
    protein/DNA complex; complexed with cl, so4, zn

Details for d2vusk_

PDB Entry: 2vus (more details), 2.6 Å

PDB Description: crystal structure of unliganded nmra-area zinc finger complex
PDB Compounds: (K:) nitrogen regulatory protein area

SCOPe Domain Sequences for d2vusk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vusk_ g.39.1.0 (K:) automated matches {Emericella nidulans [TaxId: 162425]}
ttctncftqttplwrrnpegqplcnacglflklhgvvrpls

SCOPe Domain Coordinates for d2vusk_:

Click to download the PDB-style file with coordinates for d2vusk_.
(The format of our PDB-style files is described here.)

Timeline for d2vusk_: