Lineage for d2vusk1 (2vus K:671-711)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 892407Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 892408Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (18 families) (S)
  5. 892409Family g.39.1.1: Erythroid transcription factor GATA-1 [57717] (1 protein)
    single zinc-binding motif
  6. 892410Protein Erythroid transcription factor GATA-1 [57718] (3 species)
  7. 892420Species Emericella nidulans [TaxId:162425] [161161] (3 PDB entries)
  8. 892431Domain d2vusk1: 2vus K:671-711 [153567]
    Other proteins in same PDB: d2vusa1, d2vusb1, d2vusc1, d2vusd1, d2vuse1, d2vusf1, d2vusg1, d2vush1
    automatically matched to d4gata_
    complexed with cl, so4, zn

Details for d2vusk1

PDB Entry: 2vus (more details), 2.6 Å

PDB Description: crystal structure of unliganded nmra-area zinc finger complex
PDB Compounds: (K:) nitrogen regulatory protein area

SCOP Domain Sequences for d2vusk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vusk1 g.39.1.1 (K:671-711) Erythroid transcription factor GATA-1 {Emericella nidulans [TaxId: 162425]}
ttctncftqttplwrrnpegqplcnacglflklhgvvrpls

SCOP Domain Coordinates for d2vusk1:

Click to download the PDB-style file with coordinates for d2vusk1.
(The format of our PDB-style files is described here.)

Timeline for d2vusk1: