Lineage for d2vusf_ (2vus F:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2090553Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 protein domains)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2091795Protein automated matches [190085] (51 species)
    not a true protein
  7. 2091891Species Emericella nidulans [TaxId:162425] [187249] (3 PDB entries)
  8. 2091905Domain d2vusf_: 2vus F: [153562]
    Other proteins in same PDB: d2vusi_, d2vusj_, d2vusk_, d2vusl_, d2vusm_, d2vusn_, d2vuso_, d2vusp_
    automated match to d1k6jb_
    protein/DNA complex; complexed with cl, so4, zn

Details for d2vusf_

PDB Entry: 2vus (more details), 2.6 Å

PDB Description: crystal structure of unliganded nmra-area zinc finger complex
PDB Compounds: (F:) nitrogen metabolite repression regulator nmra

SCOPe Domain Sequences for d2vusf_:

Sequence, based on SEQRES records: (download)

>d2vusf_ c.2.1.2 (F:) automated matches {Emericella nidulans [TaxId: 162425]}
qqkktiavvnatgrqaaslirvaaavghhvraqvhslkgliaeelqaipnvtlfqgplln
nvplmdtlfegahlafinttsqagdeiaigkdladaakragtiqhyiyssmpdhslygpw
pavpmwapkftvenyvrqlglpstfvyagiynnnftslpyplfqmelmpdgtfewhapfd
pdiplpwldaehdvgpallqifkdgpqkwnghrialtfetlspvqvcaafsralnrrvty
vqvpkveikvnipvgyreqleaievvfgehkapyfplpefsrpaagspkglgpangkgag
agmmqgpggvisqrvtdearklwsgwrdmeeyarevfpieeeangldwml

Sequence, based on observed residues (ATOM records): (download)

>d2vusf_ c.2.1.2 (F:) automated matches {Emericella nidulans [TaxId: 162425]}
qqkktiavvnatgrqaaslirvaaavghhvraqvhslkgliaeelqaipnvtlfqgplln
nvplmdtlfegahlafinttsqagdeiaigkdladaakragtiqhyiyssmpdhslygpw
pavpmwapkftvenyvrqlglpstfvyagiynnnftslpyplfqmelmpdgtfewhapfd
pdiplpwldaehdvgpallqifkdgpqkwnghrialtfetlspvqvcaafsralnrrvty
vqvpkveikvnipvgyreqleaievvfgehkapyfplpefsrvtdearklwsgwrdmeey
arevfpieeeangldwml

SCOPe Domain Coordinates for d2vusf_:

Click to download the PDB-style file with coordinates for d2vusf_.
(The format of our PDB-style files is described here.)

Timeline for d2vusf_: