![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.11: RNA polymerase subunit RPB10 [46924] (1 family) ![]() automatically mapped to Pfam PF01194 |
![]() | Family a.4.11.1: RNA polymerase subunit RPB10 [46925] (2 proteins) Zn-binding site is near the N-terminus |
![]() | Protein RNA polymerase subunit RPB10 [46926] (3 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63490] (28 PDB entries) Uniprot P22139; part of multichain biological unit |
![]() | Domain d2vumj1: 2vum J:1-65 [153554] Other proteins in same PDB: d2vuma1, d2vumb1, d2vumd1, d2vumf1, d2vumg1, d2vumh1, d2vumk1, d2vuml1 automatically matched to d1i3qj_ protein/DNA complex; protein/RNA complex; complexed with mg, zn |
PDB Entry: 2vum (more details), 3.4 Å
SCOPe Domain Sequences for d2vumj1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vumj1 a.4.11.1 (J:1-65) RNA polymerase subunit RPB10 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf lrynp
Timeline for d2vumj1: