Lineage for d2vumb1 (2vum B:20-1224)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1954356Fold e.29: beta and beta-prime subunits of DNA dependent RNA-polymerase [64483] (1 superfamily)
    Multidomain subunits of complex domain organization
  4. 1954357Superfamily e.29.1: beta and beta-prime subunits of DNA dependent RNA-polymerase [64484] (2 families) (S)
    The catalytic site is formed by the association of two double-psi beta-barrel domains, one from each subunit
  5. 1954358Family e.29.1.1: RNA-polymerase beta [64485] (3 proteins)
  6. 1954359Protein RBP2 [64491] (2 species)
  7. 1954360Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64492] (27 PDB entries)
    Uniprot P08518; part of multichain biological unit
  8. 1954376Domain d2vumb1: 2vum B:20-1224 [153549]
    Other proteins in same PDB: d2vuma1, d2vumd1, d2vumf1, d2vumg1, d2vumh1, d2vumj1, d2vumk1, d2vuml1
    automatically matched to d1i50b_
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d2vumb1

PDB Entry: 2vum (more details), 3.4 Å

PDB Description: alpha-amanitin inhibited complete rna polymerase ii elongation complex
PDB Compounds: (B:) DNA-directed RNA polymerase II subunit RPB2

SCOPe Domain Sequences for d2vumb1:

Sequence, based on SEQRES records: (download)

>d2vumb1 e.29.1.1 (B:20-1224) RBP2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
desapitaedswavisaffrekglvsqqldsfnqfvdytlqdiicedstlileqlaqhtt
esdnisrkyeisfgkiyvtkpmvnesdgvthalypqearlrnltyssglfvdvkkrtyea
idvpgrelkyeliaeeseddsesgkvfigrlpimlrskncylseatesdlyklkecpfdm
ggyfiingsekvliaqersagnivqvfkkaapspishvaeirsalekgsrfistlqvkly
gregssartikatlpyikqdipiviifralgiipdgeilehicydvndwqmlemlkpcve
dgfviqdretaldfigrrgtalgikkekriqyakdilqkeflphitqlegfesrkafflg
yminrlllcaldrkdqddrdhfgkkrldlagpllaqlfktlfkkltkdifrymqrtveea
hdfnmklainaktitsglkyalatgnwgeqkkamssragvsqvlnrytysstlshlrrtn
tpigrdgklakprqlhnthwglvcpaetpegqacglvknlslmscisvgtdpmpiitfls
ewgmepledyvphqspdatrvfvngvwhgvhrnparlmetlrtlrrkgdinpevsmirdi
rekelkiftdagrvyrplfiveddeslghkelkvrkghiaklmateyqdieggfedveey
twssllneglveyidaeeeesiliamqpedlepaeaneendldvdpakrirvshhattft
hceihpsmilgvaasiipfpdhnqsprntyqsamgkqamgvfltnynvrmdtmanilyyp
qkplgttrameylkfrelpagqnaivaiacysgynqedsmimnqssidrglfrslffrsy
mdqekkygmsitetfekpqrtntlrmkhgtydkldddgliapgvrvsgedviigkttpis
pdeeelgqrtayhskrdastplrstengivdqvlvttnqdglkfvkvrvrttkipqigdk
fasrhgqkgtigityrredmpftaegivpdliinphaipsrmtvahliecllskvaalsg
negdaspftditvegiskllrehgyqsrgfevmynghtgkklmaqiffgptyyqrlrhmv
ddkiharargpmqvltrqpvegrsrdgglrfgemerdcmiahgaasflkerlmeasdafr
vhicgicglmtviaklnhnqfeckgcdnkidiyqihipyaakllfqelmamnitprlytd
rsrdf

Sequence, based on observed residues (ATOM records): (download)

>d2vumb1 e.29.1.1 (B:20-1224) RBP2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
desapitaedswavisaffrekglvsqqldsfnqfvdytlqdiicedstliisfgkiyvt
kpmvnesdgvthalypqearlrnltyssglfvdvkkkvfigrlpimlrskncylseates
dlyklkecpfdmggyfiingsekvliaqersagnivqvfkkaapspishvaeirsalekg
srfistlqvklygregssartikatlpyikqdipiviifralgiipdgeilehicydvnd
wqmlemlkpcvedgfviqdretaldfigkekriqyakdilqkeflphitqlegfesrkaf
flgyminrlllcaldrkdqddrdhfgkkrldlagpllaqlfktlfkkltkdifrymqrtv
elainaktitsglkyalatgnwgeqkkamssragvsqvlnrytysstlshlrrtntpiak
prqlhnthwglvcpaetpegqacglvknlslmscisvgtdpmpiitflsewgmepledyv
phqspdatrvfvngvwhgvhrnparlmetlrtlrrkgdinpevsmirdirekelkiftda
grvyrplfiveddeslghkelkvrkghiaklmateyqdeytwssllneglveyidaeeee
siliamqpedlepaeadvdpakrirvshhattfthceihpsmilgvaasiipfpdhnqsp
rntyqsamgkqamgvfltnynvrmdtmanilyypqkplgttrameylkfrelpagqnaiv
aiacysgynqedsmimnqssidrglfrslffrsymdqekkygmsitetfekpqrtntlrm
khgtydkldddgliapgvrvsgedviigkttpisskrdastplrstengivdqvlvttnq
dglkfvkvrvrttkipqigdkfasrhgqkgtigityrredmpftaegivpdliinphaip
srmtvahliecllskvaalsgnegdaspftditvegiskllrehgyqsrgfevmynghtg
kklmaqiffgptyyqrlrhmvddkiharargpmqvltrqpvegrsrdgglrfgemerdcm
iahgaasflkerlmeasdafrvhicgicglmtviaklnhnqfeckgcdnkidiyqihipy
aakllfqelmamnitprlytdrsrdf

SCOPe Domain Coordinates for d2vumb1:

Click to download the PDB-style file with coordinates for d2vumb1.
(The format of our PDB-style files is described here.)

Timeline for d2vumb1: