Lineage for d2vueb2 (2vue B:389-575)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2730252Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 2730253Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. 2730254Family a.126.1.1: Serum albumin-like [48553] (2 proteins)
  6. 2730255Protein Serum albumin [48554] (1 species)
    duplication: consists of three domains of this fold
  7. 2730256Species Human (Homo sapiens) [TaxId:9606] [48555] (96 PDB entries)
    Uniprot P02768 29-596
  8. 2730542Domain d2vueb2: 2vue B:389-575 [153547]
    automated match to d1n5ua3
    complexed with bla

Details for d2vueb2

PDB Entry: 2vue (more details), 2.42 Å

PDB Description: human serum albumin complexed with 4z,15e-bilirubin-ix-alpha
PDB Compounds: (B:) serum albumin

SCOPe Domain Sequences for d2vueb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vueb2 a.126.1.1 (B:389-575) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
kqncelfeqlgeykfqnallvrytkkvpqvstptlvevsrnlgkvgskcckhpeakrmpc
aedylsvvlnqlcvlhektpvsdrvtkccteslvnrrpcfsalevdetyvpkefnaetft
fhadictlsekerqikkqtalvelvkhkpkatkeqlkavmddfaafvekcckaddketcf
aeegkkl

SCOPe Domain Coordinates for d2vueb2:

Click to download the PDB-style file with coordinates for d2vueb2.
(The format of our PDB-style files is described here.)

Timeline for d2vueb2: