Lineage for d2vtul1 (2vtu L:130-257)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2962441Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
    6-standed beta-sheet followed with 2 helices; meander
  4. 2962442Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 2962443Family d.85.1.1: RNA bacteriophage capsid protein [55406] (6 proteins)
  6. 2962492Protein MS2 virus coat protein [55407] (1 species)
  7. 2962493Species Bacteriophage MS2 [TaxId:12022] [55408] (36 PDB entries)
    Uniprot P03612
  8. 2962600Domain d2vtul1: 2vtu L:130-257 [153543]
    automatically matched to d1aq4a_

Details for d2vtul1

PDB Entry: 2vtu (more details), 3.5 Å

PDB Description: crystal structure of bacteriophage ms2 covalent coat protein dimer
PDB Compounds: (L:) ms2 coat protein

SCOPe Domain Sequences for d2vtul1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vtul1 d.85.1.1 (L:130-257) MS2 virus coat protein {Bacteriophage MS2 [TaxId: 12022]}
anftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkytik
vevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpipsa
iaansgiy

SCOPe Domain Coordinates for d2vtul1:

Click to download the PDB-style file with coordinates for d2vtul1.
(The format of our PDB-style files is described here.)

Timeline for d2vtul1: