![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.367: EscU C-terminal domain-like [160543] (1 superfamily) alpha-beta(3)-alpha-beta-alpha(2); 3 layers, a/b/a; mixed beta-sheet, order: 4123, strand 2 is antiparallel to the rest |
![]() | Superfamily d.367.1: EscU C-terminal domain-like [160544] (2 families) ![]() |
![]() | Family d.367.1.1: EscU C-terminal domain-like [160545] (2 proteins) C-terminal part of Pfam PF01312; self-cleaving type III secretion protein domain |
![]() | Protein Surface presentation of antigens protein SpaS [160548] (2 species) |
![]() | Species Shigella flexneri [TaxId:623] [160549] (1 PDB entry) Uniprot P0A1M8 237-257,258-338 |
![]() | Domain d2vt1.1: 2vt1 A:237-257,B:258-338 [153537] |
PDB Entry: 2vt1 (more details), 2 Å
SCOPe Domain Sequences for d2vt1.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g2vt1.1 d.367.1.1 (A:237-257,B:258-338) Surface presentation of antigens protein SpaS {Shigella flexneri [TaxId: 623]} ieilseqtksdirnsklvvmnXpthiaigiyfnpeiapapfislietnqcalavrkyane vgiptvrdvklarklykthtkysfvdfehldevlrlivwleqv
Timeline for d2vt1.1: