Lineage for d2vt0b1 (2vt0 B:1-77,B:432-496)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2810331Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2810332Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2810765Family b.71.1.2: Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 [89388] (4 proteins)
    interrupted by the catalytic domain; the C-terminal core is similar to the alpha-amylase domain
  6. 2810824Protein Glucosylceramidase [89389] (1 species)
    glycosyl hydrolase family 30; the N-terminal extension wraps around the C-terminal core
  7. 2810825Species Human (Homo sapiens) [TaxId:9606] [89390] (23 PDB entries)
  8. 2810849Domain d2vt0b1: 2vt0 B:1-77,B:432-496 [153535]
    Other proteins in same PDB: d2vt0a2, d2vt0b2
    automatically matched to d1ogsa1
    complexed with cbu, so4

Details for d2vt0b1

PDB Entry: 2vt0 (more details), 2.15 Å

PDB Description: x-ray structure of a conjugate with conduritol-beta-epoxide of acid- beta-glucosidase overexpressed in cultured plant cells
PDB Compounds: (B:) glucosylceramidase

SCOPe Domain Sequences for d2vt0b1:

Sequence, based on SEQRES records: (download)

>d2vt0b1 b.71.1.2 (B:1-77,B:432-496) Glucosylceramidase {Human (Homo sapiens) [TaxId: 9606]}
arpcipksfgyssvvcvcnatycdsfdpptfpalgtfsryestrsgrrmelsmgpiqanh
tgtgllltlqpeqkfqkXqrvglvasqkndldavalmhpdgsavvvvlnrsskdvpltik
dpavgfletispgysihtylwhr

Sequence, based on observed residues (ATOM records): (download)

>d2vt0b1 b.71.1.2 (B:1-77,B:432-496) Glucosylceramidase {Human (Homo sapiens) [TaxId: 9606]}
arpcipksfgyssvvcvcnatycdsflgtfsryestrsgrrmelsmgpiqanhtgtglll
tlqpeqkfqkXqrvglvasqkndldavalmhpdgsavvvvlnrsskdvpltikdpavgfl
etispgysihtylwhr

SCOPe Domain Coordinates for d2vt0b1:

Click to download the PDB-style file with coordinates for d2vt0b1.
(The format of our PDB-style files is described here.)

Timeline for d2vt0b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2vt0b2